Low

AMIC  A25L016M-F  Flash-Speicher, Niederspannung, 16 Mbit, 16M x 1 Bit, 100 MHz, Seriell, SPI, SOP, 8 Pin(s)

AMIC A25L016M-F
Technical Data Sheet (675.60KB) EN Technische Dokumentation anzeigen

Abbildung ggf. ähnlich. Alle Angaben ohne Gewähr. Ausschlaggebend sind die Produktinformationen des Herstellers.

Produktbeschreibung

The A25L016M-F is a 16Mbit Serial Flash Memory with advanced write protection mechanisms, accessed by a high speed SPI-compatible bus. The memory can be programmed 1 to 256 bytes at a time, using the Page Program instruction. The whole memory can be erased using the Chip Erase instruction, a block at a time, using Block Erase instruction or a sector at a time, using the Sector Erase instruction. To program one data byte, two instructions are required: Write Enable (WREN), which is one byte and a page program (PP) sequence, which consists of four bytes plus data. This is followed by the internal program cycle (of duration tPP). To spread this overhead, the page program (PP) instruction allows up to 256 bytes to be programmed at a time (changing bits from 1 to 0), provided that they lie in consecutive addresses on the same page of memory.
  • Flexible sector architecture with 4kB sectors
  • Page program (up to 256-byte) in 2ms (typical)
  • SPI bus compatible serial interface
  • JEDEC Standard 2-byte signature
  • 100MHz Clock rate (maximum)

Produktspezifikationen

Speichergröße:
16Mbit
Speicherkonfiguration Flash:
16M x 1 Bit
Taktfrequenz:
100MHz
IC-Schnittstelle:
Seriell, SPI
Bauform:
SOP
Anzahl der Pins:
8Pin(s)
Zugriffszeit:
-
Versorgungsspannung, min.:
2.7V
Versorgungsspannung, max.:
3.6V
Betriebstemperatur, min.:
0°C
Betriebstemperatur, max.:
70°C
Verpackung:
Stückweise
Produktpalette:
3V Serial NOR Flash Memories
Speicher:
Flash
MSL:
-
SVHC:
To Be Advised

Finden Sie ähnliche Produkte  sortiert nach gemeinsamen Eigenschaften

Anwendungen

  • Computer & Computerperipheriegeräte

Gesetzgebung und Umweltschutz

Feuchtigkeitsempfindlichkeitslevel:
-
Herkunftsland:
Taiwan

Land, in dem der letzte Fertigungsprozeß ausgeführt wurde.

RoHS-konform:
Ja
Tarif-Nr.:
85423261
Gewicht (kg):
.002722

Ähnliche Produkte

Sie können nach Produkten mit einer ähnlichen Funktionalität wie dieser suchen. Wählen Sie einen der folgenden Links aus. Sie gelangen dann auf eine Seite für Produktgruppen, auf der alle Produkte in dieser Kategorie aufgeführt werden, die über dieses bestimmte Attribut verfügen.